PDB entry 2f8t

View 2f8t on RCSB PDB site
Description: Crystal structure of Aa-Ago with externally-bound siRNA
Class: RNA binding protein/RNA
Keywords: Argonaute, siRNA, RISC loading complex, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2005-12-03, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.209
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argonaute protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f8ta1, d2f8ta3, d2f8ta4
  • Chain 'B':
    Compound: Argonaute protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2f8tb1, d2f8tb3, d2f8tb4
  • Chain 'C':
    Compound: 26-mer
  • Chain 'D':
    Compound: 26-mer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f8tA (A:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8tA (A:)
    keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
    vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
    rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
    irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
    vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
    wyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvy
    kklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlviv
    fleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktg
    nipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgek
    ltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrn
    nprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsl
    tlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f8tB (B:)
    mgkeallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwca
    gkvekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfyk
    kfrdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnp
    krirvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaf
    lvvlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrd
    ygwyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvs
    vykklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlv
    ivfleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlak
    tgnipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafg
    ekltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiik
    rnnprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqil
    sltlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f8tB (B:)
    keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
    vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
    rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
    irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
    vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
    wyispeeerakgklnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvy
    kklewrkeeflkelinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlviv
    fleeypkvdpyksfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktg
    nipyklkeiegkvdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgek
    ltekaigdvfslleklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrn
    nprffsnekfikgyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsl
    tlmnyssfqpiklpatvhysdkitklmlrgiepikkegdimywl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.