Lineage for d2f8tb1 (2f8t B:3-314)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394857Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2394858Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 2394888Protein automated matches [191296] (2 species)
    not a true protein
  7. 2394889Species Aquifex aeolicus [TaxId:63363] [255166] (2 PDB entries)
  8. 2394893Domain d2f8tb1: 2f8t B:3-314 [133146]
    Other proteins in same PDB: d2f8ta3, d2f8ta4, d2f8tb3, d2f8tb4
    automated match to d1yvua1
    protein/RNA complex

Details for d2f8tb1

PDB Entry: 2f8t (more details), 3.1 Å

PDB Description: Crystal structure of Aa-Ago with externally-bound siRNA
PDB Compounds: (B:) Argonaute protein

SCOPe Domain Sequences for d2f8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8tb1 b.34.14.1 (B:3-314) automated matches {Aquifex aeolicus [TaxId: 63363]}
keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk
vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf
rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr
irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv
vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg
wyispeeerakg

SCOPe Domain Coordinates for d2f8tb1:

Click to download the PDB-style file with coordinates for d2f8tb1.
(The format of our PDB-style files is described here.)

Timeline for d2f8tb1: