Lineage for d2f8na_ (2f8n A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082815Protein Histone H3 [47122] (6 species)
  7. 1082816Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1082876Domain d2f8na_: 2f8n A: [133133]
    Other proteins in same PDB: d2f8nb_, d2f8nd_, d2f8nf_, d2f8ng_, d2f8nh_, d2f8nk1
    automated match to d1kx5a_
    protein/DNA complex

Details for d2f8na_

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d2f8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8na_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2f8na_:

Click to download the PDB-style file with coordinates for d2f8na_.
(The format of our PDB-style files is described here.)

Timeline for d2f8na_: