SCOPe 2.03: Domain d2f8ab_: 2f8a B:

Lineage for d2f8ab_ (2f8a B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Glutathione peroxidase [52902] (2 species)
   contains many insertions in the common fold

7. Species Human (Homo sapiens) [TaxId:9606] [142365] (1 PDB entry)
   Uniprot P07203 12-195

8. Domain d2f8ab_: 2f8a B: [133120]
   automated match to d2f8aa1
   complexed with mla; mutant

Details for d2f8ab_

PDB Entry: 2f8a, 1.5 Å

PDB Description: crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 1

PDB Compounds: (B:) Glutathione peroxidase 1

SCOPe Domain Sequences for d2f8ab_:

Sequence; same for both SEQRES and ATOM records:

>d2f8ab_ c.47.1.10 (B:) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}
qsvyafsarplaggepvslgslrgkvllienvaslggttvrdytqmnelqrrlgprglvv
lgfpcnqfghqenakneeilnslkyvrpgggfepnfmlfekcevngagahplfaflreal
papsddatalmtdpklitwspvcrndvawnfekflvgpdgvplrrysrrfqtidiepdie
alls

Timeline for d2f8ab_:

• d2f8ab_ first appeared in SCOP 1.73, called d2f8ab1
  
• d2f8ab_ was called d2f8ab1 in SCOPe 2.02
  
• d2f8ab_ appears in SCOPe 2.04
  
• d2f8ab_ appears in the current release, SCOPe 2.08