Lineage for d2f8ab_ (2f8a B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877606Protein Glutathione peroxidase [52902] (2 species)
    contains many insertions in the common fold
  7. 2877610Species Human (Homo sapiens) [TaxId:9606] [142365] (1 PDB entry)
    Uniprot P07203 12-195
  8. 2877612Domain d2f8ab_: 2f8a B: [133120]
    Other proteins in same PDB: d2f8aa2
    automated match to d2f8aa1
    complexed with mla; mutant

Details for d2f8ab_

PDB Entry: 2f8a (more details), 1.5 Å

PDB Description: crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 1
PDB Compounds: (B:) Glutathione peroxidase 1

SCOPe Domain Sequences for d2f8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ab_ c.47.1.10 (B:) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}
qsvyafsarplaggepvslgslrgkvllienvaslggttvrdytqmnelqrrlgprglvv
lgfpcnqfghqenakneeilnslkyvrpgggfepnfmlfekcevngagahplfaflreal
papsddatalmtdpklitwspvcrndvawnfekflvgpdgvplrrysrrfqtidiepdie
alls

SCOPe Domain Coordinates for d2f8ab_:

Click to download the PDB-style file with coordinates for d2f8ab_.
(The format of our PDB-style files is described here.)

Timeline for d2f8ab_: