SCOPe 2.07: Domain d2f7wb_: 2f7w B:

Lineage for d2f7wb_ (2f7w B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [187084] (2 PDB entries)

8. Domain d2f7wb_: 2f7w B: [133107]
   Other proteins in same PDB: d2f7wa1
   automated match to d1di6a_

Details for d2f7wb_

PDB Entry: 2f7w, 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis

PDB Compounds: (B:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d2f7wb_:

Sequence; same for both SEQRES and ATOM records:

>d2f7wb_ c.57.1.0 (B:) automated matches {Shewanella oneidensis [TaxId: 70863]}
skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm
adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta
glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

Timeline for d2f7wb_:

• d2f7wb_ first appeared in SCOP 1.73, called d2f7wb1
  
• d2f7wb_ appears in SCOPe 2.06
  
• d2f7wb_ appears in the current release, SCOPe 2.08