![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
![]() | Protein automated matches [190284] (9 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:70863] [187084] (2 PDB entries) |
![]() | Domain d2f7wc_: 2f7w C: [133108] Other proteins in same PDB: d2f7wa1 automated match to d1di6a_ |
PDB Entry: 2f7w (more details), 1.9 Å
SCOPe Domain Sequences for d2f7wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7wc_ c.57.1.0 (C:) automated matches {Shewanella oneidensis [TaxId: 70863]} skakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikm adeqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqta glrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp
Timeline for d2f7wc_: