Lineage for d2f73g2 (2f73 G:1-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396202Protein Liver fatty acid binding protein [50866] (3 species)
  7. 2396207Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries)
    Uniprot P07148 1-127
  8. 2396227Domain d2f73g2: 2f73 G:1-127 [133077]
    Other proteins in same PDB: d2f73a2, d2f73b3, d2f73c3, d2f73d3, d2f73e3, d2f73f3, d2f73g3, d2f73h3
    automated match to d2f73a1

Details for d2f73g2

PDB Entry: 2f73 (more details), 2.5 Å

PDB Description: Crystal structure of human fatty acid binding protein 1 (FABP1)
PDB Compounds: (G:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2f73g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f73g2 b.60.1.2 (G:1-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskri

SCOPe Domain Coordinates for d2f73g2:

Click to download the PDB-style file with coordinates for d2f73g2.
(The format of our PDB-style files is described here.)

Timeline for d2f73g2: