| Class b: All beta proteins [48724] (180 folds) |
| Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
| Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
| Protein Liver fatty acid binding protein [50866] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries) Uniprot P07148 1-127 |
| Domain d2f73a1: 2f73 A:1-127 [133071] Other proteins in same PDB: d2f73a2, d2f73b3, d2f73c3, d2f73d3, d2f73e3, d2f73f3, d2f73g3, d2f73h3 |
PDB Entry: 2f73 (more details), 2.5 Å
SCOPe Domain Sequences for d2f73a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f73a1 b.60.1.2 (A:1-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
msfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskri
Timeline for d2f73a1: