Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.3: Crotonase-like [52103] (13 proteins) |
Protein Peroxisomal 3,2-trans-enoyl-CoA isomerase [142006] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142007] (1 PDB entry) Uniprot O75521 103-347 |
Domain d2f6qb1: 2f6q B:109-352 [133056] automatically matched to 2F6Q A:108-352 complexed with trs |
PDB Entry: 2f6q (more details), 1.95 Å
SCOP Domain Sequences for d2f6qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6qb1 c.14.1.3 (B:109-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} fetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyyss gndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfd avyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvt evfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsd ectn
Timeline for d2f6qb1: