Lineage for d2f6qb1 (2f6q B:109-352)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824703Protein Peroxisomal 3,2-trans-enoyl-CoA isomerase [142006] (1 species)
  7. 824704Species Human (Homo sapiens) [TaxId:9606] [142007] (1 PDB entry)
    Uniprot O75521 103-347
  8. 824706Domain d2f6qb1: 2f6q B:109-352 [133056]
    automatically matched to 2F6Q A:108-352
    complexed with trs

Details for d2f6qb1

PDB Entry: 2f6q (more details), 1.95 Å

PDB Description: The crystal structure of human peroxisomal delta3, delta2 enoyl CoA isomerase (PECI)
PDB Compounds: (B:) Peroxisomal 3,2-trans-enoyl-CoA isomerase

SCOP Domain Sequences for d2f6qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6qb1 c.14.1.3 (B:109-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}
fetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyyss
gndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfd
avyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvt
evfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsd
ectn

SCOP Domain Coordinates for d2f6qb1:

Click to download the PDB-style file with coordinates for d2f6qb1.
(The format of our PDB-style files is described here.)

Timeline for d2f6qb1: