Lineage for d2f6qb_ (2f6q B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853268Protein Peroxisomal 3,2-trans-enoyl-CoA isomerase [142006] (1 species)
  7. 2853269Species Human (Homo sapiens) [TaxId:9606] [142007] (1 PDB entry)
    Uniprot O75521 103-347
  8. 2853271Domain d2f6qb_: 2f6q B: [133056]
    Other proteins in same PDB: d2f6qa2
    automated match to d2f6qa1
    complexed with trs

Details for d2f6qb_

PDB Entry: 2f6q (more details), 1.95 Å

PDB Description: The crystal structure of human peroxisomal delta3, delta2 enoyl CoA isomerase (PECI)
PDB Compounds: (B:) Peroxisomal 3,2-trans-enoyl-CoA isomerase

SCOPe Domain Sequences for d2f6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6qb_ c.14.1.3 (B:) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}
fetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyyss
gndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfd
avyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvt
evfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsd
ectnavvnflsr

SCOPe Domain Coordinates for d2f6qb_:

Click to download the PDB-style file with coordinates for d2f6qb_.
(The format of our PDB-style files is described here.)

Timeline for d2f6qb_: