SCOPe 2.01: Domain d2f6qb1: 2f6q B:109-352

Lineage for d2f6qb1 (2f6q B:109-352)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Peroxisomal 3,2-trans-enoyl-CoA isomerase [142006] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142007] (1 PDB entry)
   Uniprot O75521 103-347

8. Domain d2f6qb1: 2f6q B:109-352 [133056]
   automatically matched to 2F6Q A:108-352
   complexed with trs

Details for d2f6qb1

PDB Entry: 2f6q, 1.95 Å

PDB Description: The crystal structure of human peroxisomal delta3, delta2 enoyl CoA isomerase (PECI)

PDB Compounds: (B:) Peroxisomal 3,2-trans-enoyl-CoA isomerase

SCOPe Domain Sequences for d2f6qb1:

Sequence; same for both SEQRES and ATOM records:

>d2f6qb1 c.14.1.3 (B:109-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}
fetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyyss
gndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfd
avyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvt
evfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsd
ectn

Timeline for d2f6qb1:

• d2f6qb1 first appeared in SCOP 1.73
  
• d2f6qb1 appears in SCOP 1.75
  
• d2f6qb1 appears in SCOPe 2.02
  
• d2f6qb1 appears in the current release, SCOPe 2.08, called d2f6qb_