SCOPe 2.07: Domain d2f5qa3: 2f5q A:229-274

Lineage for d2f5qa3 (2f5q A:229-274)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)

6. Protein DNA repair protein MutM (Fpg) [81622] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries)

8. Domain d2f5qa3: 2f5q A:229-274 [133006]
   Other proteins in same PDB: d2f5qa1, d2f5qa2
   automatically matched to d1r2ya3
   protein/DNA complex; complexed with zn

Details for d2f5qa3

PDB Entry: 2f5q, 2.35 Å

PDB Description: catalytically inactive (e3q) mutm crosslinked to oxog:c containing dna cc2

PDB Compounds: (A:) formamidopyrimidine-DNA glycosidase

SCOPe Domain Sequences for d2f5qa3:

Sequence; same for both SEQRES and ATOM records:

>d2f5qa3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

Timeline for d2f5qa3:

• d2f5qa3 first appeared in SCOP 1.73
  
• d2f5qa3 appears in SCOPe 2.06
  
• d2f5qa3 appears in the current release, SCOPe 2.08