SCOPe 2.07: Domain d2f5qa2: 2f5q A:2-134

Lineage for d2f5qa2 (2f5q A:2-134)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries)

8. Domain d2f5qa2: 2f5q A:2-134 [133005]
   Other proteins in same PDB: d2f5qa1, d2f5qa3
   automatically matched to d1r2ya2
   protein/DNA complex; complexed with zn

Details for d2f5qa2

PDB Entry: 2f5q, 2.35 Å

PDB Description: catalytically inactive (e3q) mutm crosslinked to oxog:c containing dna cc2

PDB Compounds: (A:) formamidopyrimidine-DNA glycosidase

SCOPe Domain Sequences for d2f5qa2:

Sequence; same for both SEQRES and ATOM records:

>d2f5qa2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

Timeline for d2f5qa2:

• d2f5qa2 first appeared in SCOP 1.73
  
• d2f5qa2 appears in SCOPe 2.06
  
• d2f5qa2 appears in the current release, SCOPe 2.08