Lineage for d2f5ca2 (2f5c A:63-136)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092382Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1092383Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 1092384Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 1092442Protein Manganese transport regulator MntR [89086] (1 species)
  7. 1092443Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 1092460Domain d2f5ca2: 2f5c A:63-136 [132978]
    Other proteins in same PDB: d2f5ca1
    automatically matched to d1on1a2
    complexed with mn, so4

Details for d2f5ca2

PDB Entry: 2f5c (more details), 2.4 Å

PDB Description: Bacillus subtilis Manganese transport regulator (MNTR) bound to manganese, hexagonal crystal form
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2f5ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5ca2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOPe Domain Coordinates for d2f5ca2:

Click to download the PDB-style file with coordinates for d2f5ca2.
(The format of our PDB-style files is described here.)

Timeline for d2f5ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5ca1