Lineage for d2f5ca1 (2f5c A:3-62)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079858Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)
  6. 1079916Protein Manganese transport regulator MntR [88986] (1 species)
  7. 1079917Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)
  8. 1079934Domain d2f5ca1: 2f5c A:3-62 [132977]
    Other proteins in same PDB: d2f5ca2
    automatically matched to d1on1a1
    complexed with mn, so4

Details for d2f5ca1

PDB Entry: 2f5c (more details), 2.4 Å

PDB Description: Bacillus subtilis Manganese transport regulator (MNTR) bound to manganese, hexagonal crystal form
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2f5ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5ca1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

SCOPe Domain Coordinates for d2f5ca1:

Click to download the PDB-style file with coordinates for d2f5ca1.
(The format of our PDB-style files is described here.)

Timeline for d2f5ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5ca2