![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein Barnase [81305] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (45 PDB entries) |
![]() | Domain d2f56a_: 2f56 A: [132974] automated match to d1b27a_ complexed with ure, zn |
PDB Entry: 2f56 (more details), 1.96 Å
SCOPe Domain Sequences for d2f56a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f56a_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d2f56a_: