SCOPe 2.08: Domain d2f56a_: 2f56 A:

Lineage for d2f56a_ (2f56 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d2f56a_: 2f56 A: [132974]
   automated match to d1b27a_
   complexed with ure, zn

Details for d2f56a_

PDB Entry: 2f56, 1.96 Å

PDB Description: barnase cross-linked with glutaraldehyde soaked in 6m urea

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2f56a_:

Sequence; same for both SEQRES and ATOM records:

>d2f56a_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d2f56a_:

• d2f56a_ first appeared in SCOP 1.73, called d2f56a1
  
• d2f56a_ appears in SCOPe 2.07