Class a: All alpha proteins [46456] (285 folds) |
Fold a.189: XPC-binding domain [101237] (1 superfamily) 4 helices; array |
Superfamily a.189.1: XPC-binding domain [101238] (2 families) |
Family a.189.1.1: XPC-binding domain [101239] (4 proteins) |
Protein automated matches [190283] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187083] (2 PDB entries) |
Domain d2f4mb_: 2f4m B: [132931] Other proteins in same PDB: d2f4ma1 automated match to d1pvea_ complexed with cl, zn |
PDB Entry: 2f4m (more details), 1.85 Å
SCOPe Domain Sequences for d2f4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4mb_ a.189.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv g
Timeline for d2f4mb_: