SCOPe 2.08: Domain d2f4mb2: 2f4m B:273-332

Lineage for d2f4mb2 (2f4m B:273-332)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.189: XPC-binding domain-like [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (2 families)

5. Family a.189.1.1: XPC-binding domain [101239] (4 proteins)

6. Protein automated matches [190283] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187083] (2 PDB entries)

8. Domain d2f4mb2: 2f4m B:273-332 [132931]
   Other proteins in same PDB: d2f4ma1, d2f4ma2, d2f4mb3
   automated match to d1pvea_
   complexed with cl, zn

Details for d2f4mb2

PDB Entry: 2f4m, 1.85 Å

PDB Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs

PDB Compounds: (B:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d2f4mb2:

Sequence; same for both SEQRES and ATOM records:

>d2f4mb2 a.189.1.1 (B:273-332) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghpleflrnqpqfqqmrqiiqqnpsllpallqqigrenpqllqqisqhqehfiqmlnepv

Timeline for d2f4mb2:

• d2f4mb2 first appeared in SCOP 1.73, called d2f4mb1
  
• d2f4mb2 appears in SCOPe 2.07