Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein) |
Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
Domain d2f2hb3: 2f2h B:586-665 [132824] Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha4, d2f2hb1, d2f2hb2, d2f2hb4, d2f2hc1, d2f2hc2, d2f2hc4, d2f2hd1, d2f2hd2, d2f2hd4, d2f2he1, d2f2he2, d2f2he4, d2f2hf1, d2f2hf2, d2f2hf4 automated match to d2f2ha3 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2hb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hb3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d2f2hb3: