Lineage for d2f2hb3 (2f2h B:586-665)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 676233Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 676234Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 676235Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
  8. 676237Domain d2f2hb3: 2f2h B:586-665 [132824]
    Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha4, d2f2hb1, d2f2hb2, d2f2hb4, d2f2hc1, d2f2hc2, d2f2hc4, d2f2hd1, d2f2hd2, d2f2hd4, d2f2he1, d2f2he2, d2f2he4, d2f2hf1, d2f2hf2, d2f2hf4
    automatically matched to 2F2H A:586-665
    complexed with gol, mpo, so4, xtg

Details for d2f2hb3

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2hb3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOP Domain Coordinates for d2f2hb3:

Click to download the PDB-style file with coordinates for d2f2hb3.
(The format of our PDB-style files is described here.)

Timeline for d2f2hb3: