| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Viral cyclin [47961] (3 species) |
| Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) |
| Domain d2f2ca2: 2f2c A:149-254 [132806] Other proteins in same PDB: d2f2cb_ automated match to d1jowa2 complexed with ap9, dms, so4 |
PDB Entry: 2f2c (more details), 2.8 Å
SCOPe Domain Sequences for d2f2ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ca2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil
Timeline for d2f2ca2: