Lineage for d2f2ca2 (2f2c A:149-254)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644248Protein Viral cyclin [47961] (3 species)
  7. 644249Species Herpesvirus saimiri [TaxId:10381] [47962] (5 PDB entries)
  8. 644251Domain d2f2ca2: 2f2c A:149-254 [132806]
    Other proteins in same PDB: d2f2cb1
    automatically matched to d1jowa2
    complexed with ap9, dms, so4

Details for d2f2ca2

PDB Entry: 2f2c (more details), 2.8 Å

PDB Description: x-ray structure of human cdk6-vcyclinwith the inhibitor aminopurvalanol
PDB Compounds: (A:) cyclin homolog

SCOP Domain Sequences for d2f2ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ca2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil

SCOP Domain Coordinates for d2f2ca2:

Click to download the PDB-style file with coordinates for d2f2ca2.
(The format of our PDB-style files is described here.)

Timeline for d2f2ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f2ca1
View in 3D
Domains from other chains:
(mouse over for more information)
d2f2cb1