Lineage for d2f1na1 (2f1n A:1-250)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044453Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1044454Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1044455Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1044456Protein Cytolethal distending toxin subunit B [111213] (3 species)
  7. 1044460Species Escherichia coli [TaxId:562] [143901] (1 PDB entry)
    Uniprot Q46669 19-269
  8. 1044461Domain d2f1na1: 2f1n A:1-250 [132782]

Details for d2f1na1

PDB Entry: 2f1n (more details), 1.73 Å

PDB Description: structure of cdtb, the biologically active subunit of cytolethal distending toxin
PDB Compounds: (A:) Cytolethal distending toxin subunit B

SCOPe Domain Sequences for d2f1na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]}
dltdfrvatwnlqgasatteskwninvrqlisgenavdilavqeagsppstavdtgrvip
spgipvreliwnlstnsrpqqvyiyfsavdalggrvnlalvsnrradevfvlspvrqggr
pllgirigndafftahaiamrnndapalveevynffrdsrdpvhqalnwmilgdfnrepa
dlemnltvpvrraseiispaaatqtsqrtldyavagnsvafrpsplqagivygarrtqis
sdhfpvgvsr

SCOPe Domain Coordinates for d2f1na1:

Click to download the PDB-style file with coordinates for d2f1na1.
(The format of our PDB-style files is described here.)

Timeline for d2f1na1: