![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (7 proteins) |
![]() | Protein Cytolethal distending toxin subunit B [111213] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [143901] (1 PDB entry) Uniprot Q46669 19-269 |
![]() | Domain d2f1na1: 2f1n A:1-250 [132782] |
PDB Entry: 2f1n (more details), 1.73 Å
SCOPe Domain Sequences for d2f1na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} dltdfrvatwnlqgasatteskwninvrqlisgenavdilavqeagsppstavdtgrvip spgipvreliwnlstnsrpqqvyiyfsavdalggrvnlalvsnrradevfvlspvrqggr pllgirigndafftahaiamrnndapalveevynffrdsrdpvhqalnwmilgdfnrepa dlemnltvpvrraseiispaaatqtsqrtldyavagnsvafrpsplqagivygarrtqis sdhfpvgvsr
Timeline for d2f1na1: