PDB entry 2f1n

View 2f1n on RCSB PDB site
Description: Structure of CdtB, the biologically active subunit of Cytolethal Distending Toxin
Class: toxin
Keywords: cytolethal distending toxin, CDT, e.coli, toxin, DNase I, microbatch
Deposited on 2005-11-14, released 2006-07-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytolethal distending toxin subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: cdtB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46669 (11-261)
      • cloning artifact (9-10)
      • see remark 999 (67-68)
    Domains in SCOPe 2.01: d2f1na1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1nA (A:)
    mahhhhhhvgtdltdfrvatwnlqgasatteskwninvrqlisgenavdilavqeagspp
    stavdtgrvipspgipvreliwnlstnsrpqqvyiyfsavdalggrvnlalvsnrradev
    fvlspvrqggrpllgirigndafftahaiamrnndapalveevynffrdsrdpvhqalnw
    milgdfnrepadlemnltvpvrraseiispaaatqtsqrtldyavagnsvafrpsplqag
    ivygarrtqissdhfpvgvsrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1nA (A:)
    gtdltdfrvatwnlqgasatteskwninvrqlisgenavdilavqeagsppstavdtgrv
    ipspgipvreliwnlstnsrpqqvyiyfsavdalggrvnlalvsnrradevfvlspvrqg
    grpllgirigndafftahaiamrnndapalveevynffrdsrdpvhqalnwmilgdfnre
    padlemnltvpvrraseiispaaatqtsqrtldyavagnsvafrpsplqagivygarrtq
    issdhfpvgvsrr