SCOP 1.73: Domain d2f1la2: 2f1l A:7-95

Lineage for d2f1la2 (2f1l A:7-95)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (5 families)

5. Family b.43.3.4: RimM N-terminal domain-like [141338] (1 protein)
   Pfam PF01782

6. Protein 16S rRNA processing protein RimM, N-terminal domain [141339] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141340] (1 PDB entry)

8. Domain d2f1la2: 2f1l A:7-95 [132781]
   Other proteins in same PDB: d2f1la1
   complexed with gol, unl

Details for d2f1la2

PDB Entry: 2f1l, 2.46 Å

PDB Description: crystal structure of a putative 16s ribosomal rna processing protein rimm (pa3744) from pseudomonas aeruginosa at 2.46 a resolution

PDB Compounds: (A:) 16S rRNA processing protein

SCOP Domain Sequences for d2f1la2:

Sequence; same for both SEQRES and ATOM records:

>d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
dlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdgeirqaelvrgrlhgkvla
aklkglddreeartftgyeiciprselps

Timeline for d2f1la2:

• d2f1la2 is new in SCOP 1.73
  
• d2f1la2 appears in SCOP 1.75
  
• d2f1la2 appears in the current release, SCOPe 2.08