SCOP 1.73: Domain d2f1la1: 2f1l A:101-175

Lineage for d2f1la1 (2f1l A:101-175)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families)

5. Family b.41.1.4: RimM C-terminal domain-like [141326] (1 protein)

6. Protein 16S rRNA processing protein RimM, C-terminal domain [141327] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141328] (1 PDB entry)

8. Domain d2f1la1: 2f1l A:101-175 [132780]
   Other proteins in same PDB: d2f1la2
   complexed with gol, unl

Details for d2f1la1

PDB Entry: 2f1l, 2.46 Å

PDB Description: crystal structure of a putative 16s ribosomal rna processing protein rimm (pa3744) from pseudomonas aeruginosa at 2.46 a resolution

PDB Compounds: (A:) 16S rRNA processing protein

SCOP Domain Sequences for d2f1la1:

Sequence; same for both SEQRES and ATOM records:

>d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
yywhqleglkvidqgrqllgvidhlletgandvmvvkpcagslddrerllpytgqcvlsi
dlaagemrvdwdadf

Timeline for d2f1la1:

• d2f1la1 is new in SCOP 1.73
  
• d2f1la1 appears in SCOP 1.75
  
• d2f1la1 appears in the current release, SCOPe 2.08