PDB entry 2f1l

View 2f1l on RCSB PDB site
Description: Crystal structure of 16S rRNA processing protein from Pseudomonas aeruginosa at 2.46 A resolution
Class: structural genomics, unknown function
Keywords: 9949912, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2005-11-14, released 2006-02-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S rRNA processing protein
    Species: Pseudomonas aeruginosa
    Gene: 9949912
    Database cross-references and differences (RAF-indexed):
    • GB AAG07131 (Start-186)
      • modified residue (145)
      • modified residue (178)
    Domains in SCOP 1.73: d2f1la1, d2f1la2
  • Heterogens: UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f1lA (A:)
    mgsdkihhhhhhmptpaddlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdg
    eirqaelvrgrlhgkvlaaklkglddreeartftgyeiciprselpsleegeyywhqleg
    lkvidqgrqllgvidhlletgandvmvvkpcagslddrerllpytgqcvlsidlaagemr
    vdwdadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f1lA (A:)
    dlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdgeirqaelvrgrlhgkvla
    aklkglddreeartftgyeiciprselpsyywhqleglkvidqgrqllgvidhlletgan
    dvmvvkpcagslddrerllpytgqcvlsidlaagemrvdwdadf