Lineage for d2f02a_ (2f02 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181243Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1181244Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1181435Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1181436Protein automated matches [190117] (18 species)
    not a true protein
  7. 1181451Species Enterococcus faecalis [TaxId:226185] [187075] (1 PDB entry)
  8. 1181452Domain d2f02a_: 2f02 A: [132649]
    automated match to d1o14a_
    complexed with atp

Details for d2f02a_

PDB Entry: 2f02 (more details), 1.9 Å

PDB Description: crystal structure of lacc from enterococcus faecalis in complex with atp
PDB Compounds: (A:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2f02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f02a_ c.72.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
slivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvl
ggfhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnfle
nfdqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkp
ylikpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyr
vkiptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenv
kkhlmniqvveiakeghhh

SCOPe Domain Coordinates for d2f02a_:

Click to download the PDB-style file with coordinates for d2f02a_.
(The format of our PDB-style files is described here.)

Timeline for d2f02a_: