Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Crk proto-oncogen [82741] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82742] (3 PDB entries) |
Domain d2eyya2: 2eyy A:12-120 [132605] Other proteins in same PDB: d2eyya1 automatically matched to d1ju5a_ |
PDB Entry: 2eyy (more details)
SCOPe Domain Sequences for d2eyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyya2 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr
Timeline for d2eyya2: