SCOPe 2.02: Domain d2eyya1: 2eyy A:134-190

Lineage for d2eyya1 (2eyy A:134-190)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein C-Crk, N-terminal SH3 domain [50046] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50047] (9 PDB entries)

8. Domain d2eyya1: 2eyy A:134-190 [132604]
   Other proteins in same PDB: d2eyya2
   automatically matched to d1m3ca_

Details for d2eyya1

PDB Entry: 2eyy

PDB Description: ct10-regulated kinase isoform i

PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOPe Domain Sequences for d2eyya1:

Sequence; same for both SEQRES and ATOM records:

>d2eyya1 b.34.2.1 (A:134-190) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

Timeline for d2eyya1:

• d2eyya1 first appeared in SCOP 1.73
  
• d2eyya1 appears in SCOPe 2.01
  
• d2eyya1 appears in SCOPe 2.03
  
• d2eyya1 appears in the current release, SCOPe 2.08