| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein C-Crk, N-terminal SH3 domain [50046] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [50047] (8 PDB entries) |
| Domain d2eyya1: 2eyy A:134-190 [132604] Other proteins in same PDB: d2eyya2 automatically matched to d1m3ca_ |
PDB Entry: 2eyy (more details)
SCOPe Domain Sequences for d2eyya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyya1 b.34.2.1 (A:134-190) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky
Timeline for d2eyya1: