Lineage for d2eyya1 (2eyy A:134-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782943Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 2782944Species Mouse (Mus musculus) [TaxId:10090] [50047] (8 PDB entries)
  8. 2782949Domain d2eyya1: 2eyy A:134-190 [132604]
    Other proteins in same PDB: d2eyya2
    automatically matched to d1m3ca_

Details for d2eyya1

PDB Entry: 2eyy (more details)

PDB Description: ct10-regulated kinase isoform i
PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOPe Domain Sequences for d2eyya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyya1 b.34.2.1 (A:134-190) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

SCOPe Domain Coordinates for d2eyya1:

Click to download the PDB-style file with coordinates for d2eyya1.
(The format of our PDB-style files is described here.)

Timeline for d2eyya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eyya2