SCOPe 2.08: Domain d2exkb1: 2exk B:325-535

Lineage for d2exkb1 (2exk B:325-535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)

6. Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)

7. Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries)
   Uniprot Q68HB3 325-535

8. Domain d2exkb1: 2exk B:325-535 [132553]
   Other proteins in same PDB: d2exka2, d2exkb2, d2exkc2, d2exkd2
   automated match to d2exka1
   complexed with ca, gol, mes

Details for d2exkb1

PDB Entry: 2exk, 2.2 Å

PDB Description: structure of the family43 beta-xylosidase e187g from geobacillus stearothermophilus in complex with xylobiose

PDB Compounds: (B:) beta-D-xylosidase

SCOPe Domain Sequences for d2exkb1:

Sequence; same for both SEQRES and ATOM records:

>d2exkb1 b.29.1.23 (B:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr
wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd
qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra
aftgafvgmhcrdgsgqnnyadfdyflykel

Timeline for d2exkb1:

• d2exkb1 first appeared in SCOP 1.73
  
• d2exkb1 appears in SCOPe 2.07