Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [141165] (4 PDB entries) Uniprot Q68HB3 325-535 |
Domain d2exkd1: 2exk D:325-535 [132557] Other proteins in same PDB: d2exka2, d2exkb2, d2exkc2, d2exkd2 automated match to d2exka1 complexed with ca, gol, mes |
PDB Entry: 2exk (more details), 2.2 Å
SCOPe Domain Sequences for d2exkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exkd1 b.29.1.23 (D:325-535) Beta-D-xylosidase C-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]} ekdydekddfdgdtlnhhfqtlriplgediatlkarpghlrlygresltsrftqafvarr wqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlqitwheekgrilelmtcdhlvvd qplrgreivvpddieyvylrvtvqattykysysfdgmnwidlpvtfesyklsddyiksra aftgafvgmhcrdgsgqnnyadfdyflykel
Timeline for d2exkd1: