PDB entry 2exk

View 2exk on RCSB PDB site
Description: Structure of the family43 beta-Xylosidase E187G from geobacillus stearothermophilus in complex with xylobiose
Class: hydrolase
Keywords: glykosidase, hydrolsase, xylosidase, family43, xylose, HYDROLASE
Deposited on 2005-11-08, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (186)
    Domains in SCOPe 2.07: d2exka1, d2exka2
  • Chain 'B':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (186)
    Domains in SCOPe 2.07: d2exkb1, d2exkb2
  • Chain 'C':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (186)
    Domains in SCOPe 2.07: d2exkc1, d2exkc2
  • Chain 'D':
    Compound: beta-D-xylosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68HB3 (Start-534)
      • engineered (186)
    Domains in SCOPe 2.07: d2exkd1, d2exkd2
  • Heterogens: XYS, CA, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2exkA (A:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exkA (A:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2exkB (B:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exkB (B:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2exkC (C:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exkC (C:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2exkD (D:)
    makiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrls
    qlnmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpi
    ylnssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkg
    tdlritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyp
    rnplqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdg
    wpyvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkar
    pghlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwtt
    lqitwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdg
    mnwidlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2exkD (D:)
    kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
    nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
    nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
    lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
    plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
    yvvggngpsleidgpsveevswekdydekddfdgdtlnhhfqtlriplgediatlkarpg
    hlrlygresltsrftqafvarrwqhfhfvaetkvsfrpttfqqsaglvnyyntqnwttlq
    itwheekgrilelmtcdhlvvdqplrgreivvpddieyvylrvtvqattykysysfdgmn
    widlpvtfesyklsddyiksraaftgafvgmhcrdgsgqnnyadfdyflykel