Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries) |
Domain d2exga2: 2exg A:6-101 [132526] Other proteins in same PDB: d2exga3 automated match to d1xz9a1 complexed with stf |
PDB Entry: 2exg (more details)
SCOPe Domain Sequences for d2exga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2exga2 b.36.1.1 (A:6-101) automated matches {Human (Homo sapiens) [TaxId: 9606]} lrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqlls vdgrslvglsqeraaelmtrtssvvtlevakqgaiy
Timeline for d2exga2: