SCOPe 2.06: Domain d2exga2: 2exg A:6-101

Lineage for d2exga2 (2exg A:6-101)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d2exga2: 2exg A:6-101 [132526]
   Other proteins in same PDB: d2exga3
   automated match to d1xz9a1
   complexed with stf

Details for d2exga2

PDB Entry: 2exg

PDB Description: making protein-protein interactions drugable: discovery of low- molecular-weight ligands for the af6 pdz domain

PDB Compounds: (A:) Afadin

SCOPe Domain Sequences for d2exga2:

Sequence; same for both SEQRES and ATOM records:

>d2exga2 b.36.1.1 (A:6-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqlls
vdgrslvglsqeraaelmtrtssvvtlevakqgaiy

Timeline for d2exga2:

• d2exga2 first appeared in SCOP 1.73, called d2exga1
  
• d2exga2 was called d2exga_ in SCOPe 2.05
  
• d2exga2 appears in SCOPe 2.07
  
• d2exga2 appears in the current release, SCOPe 2.08