Lineage for d2exga2 (2exg A:6-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786243Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)
  8. 2786343Domain d2exga2: 2exg A:6-101 [132526]
    Other proteins in same PDB: d2exga3
    automated match to d1xz9a1
    complexed with stf

Details for d2exga2

PDB Entry: 2exg (more details)

PDB Description: making protein-protein interactions drugable: discovery of low- molecular-weight ligands for the af6 pdz domain
PDB Compounds: (A:) Afadin

SCOPe Domain Sequences for d2exga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exga2 b.36.1.1 (A:6-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqlls
vdgrslvglsqeraaelmtrtssvvtlevakqgaiy

SCOPe Domain Coordinates for d2exga2:

Click to download the PDB-style file with coordinates for d2exga2.
(The format of our PDB-style files is described here.)

Timeline for d2exga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2exga3