SCOPe 2.04: Domain d2ex3g1: 2ex3 G:6-187

Lineage for d2ex3g1 (2ex3 G:6-187)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)

7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
   Uniprot P03680

8. Domain d2ex3g1: 2ex3 G:6-187 [132507]
   Other proteins in same PDB: d2ex3a2, d2ex3b1, d2ex3c2, d2ex3d1, d2ex3e2, d2ex3f1, d2ex3g2, d2ex3h1, d2ex3i2, d2ex3j1, d2ex3k2, d2ex3l1
   automated match to d2py5a1
   protein/DNA complex; complexed with pb

Details for d2ex3g1

PDB Entry: 2ex3, 3 Å

PDB Description: bacteriophage phi29 dna polymerase bound to terminal protein

PDB Compounds: (G:) DNA polymerase

SCOPe Domain Sequences for d2ex3g1:

Sequence; same for both SEQRES and ATOM records:

>d2ex3g1 c.55.3.5 (G:6-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
rkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlkf
agafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslkk
lpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqgl
dr

Timeline for d2ex3g1:

• d2ex3g1 first appeared in SCOP 1.73
  
• d2ex3g1 appears in SCOPe 2.03
  
• d2ex3g1 appears in SCOPe 2.05
  
• d2ex3g1 appears in the current release, SCOPe 2.08