Lineage for d2ewoh_ (2ewo H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925324Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1925325Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1925452Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1925453Protein automated matches [190175] (6 species)
    not a true protein
  7. 1925510Species Streptococcus mutans [TaxId:1309] [187074] (1 PDB entry)
  8. 1925517Domain d2ewoh_: 2ewo H: [132483]
    Other proteins in same PDB: d2ewoa1
    automated match to d1vkpa_

Details for d2ewoh_

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (H:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewoh_ d.126.1.0 (H:) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpatl

SCOPe Domain Coordinates for d2ewoh_:

Click to download the PDB-style file with coordinates for d2ewoh_.
(The format of our PDB-style files is described here.)

Timeline for d2ewoh_: