Lineage for d2ewoh1 (2ewo H:2-370)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732825Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 732826Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 732894Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 732895Protein Agmatine iminohydrolase [111156] (2 species)
  7. 732896Species Streptococcus mutans [TaxId:1309] [143807] (1 PDB entry)
  8. 732904Domain d2ewoh1: 2ewo H:2-370 [132483]
    automatically matched to 2EWO A:2-370

Details for d2ewoh1

PDB Entry: 2ewo (more details), 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.
PDB Compounds: (H:) Putative agmatine deiminase

SCOP Domain Sequences for d2ewoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewoh1 d.126.1.6 (H:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpatl

SCOP Domain Coordinates for d2ewoh1:

Click to download the PDB-style file with coordinates for d2ewoh1.
(The format of our PDB-style files is described here.)

Timeline for d2ewoh1: