SCOPe 2.08: Domain d2ewoh2: 2ewo H:2-369

Lineage for d2ewoh2 (2ewo H:2-369)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.0: automated matches [191334] (1 protein)
   not a true family

6. Protein automated matches [190175] (10 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [187074] (1 PDB entry)

8. Domain d2ewoh2: 2ewo H:2-369 [132483]
   Other proteins in same PDB: d2ewoa1, d2ewoa2, d2ewob3, d2ewoc3, d2ewod3, d2ewoe3, d2ewof3, d2ewog3, d2ewoh3, d2ewoi3, d2ewoj3, d2ewok3, d2ewol3
   automated match to d1vkpa_

Details for d2ewoh2

PDB Entry: 2ewo, 2.9 Å

PDB Description: X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6.

PDB Compounds: (H:) Putative agmatine deiminase

SCOPe Domain Sequences for d2ewoh2:

Sequence; same for both SEQRES and ATOM records:

>d2ewoh2 d.126.1.0 (H:2-369) automated matches {Streptococcus mutans [TaxId: 1309]}
akriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefep
vslcvpplqyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefn
awgglvdglyfpwdqdalvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcll
hpsrnphltkediedklkdylncvkvlwvkdgidpyetnghiddvacfirpgevaciytd
dkehpfyqeakaaydflsqqtdakgrplkvhkmcvtkepcylqeaatidyvegsipreeg
emaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvvgvrteeiaygggnihc
itqqqpat

Timeline for d2ewoh2:

• d2ewoh2 first appeared in SCOP 1.73, called d2ewoh1
  
• d2ewoh2 appears in SCOPe 2.07