SCOPe 2.07: Domain d2ew8b_: 2ew8 B:

Lineage for d2ew8b_ (2ew8 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Azoarcus sp. [TaxId:76114] [187073] (1 PDB entry)

8. Domain d2ew8b_: 2ew8 B: [132448]
   Other proteins in same PDB: d2ew8a1
   automated match to d1i01a_
   complexed with so4

Details for d2ew8b_

PDB Entry: 2ew8, 2.1 Å

PDB Description: crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1

PDB Compounds: (B:) (S)-1-Phenylethanol dehydrogenase

SCOPe Domain Sequences for d2ew8b_:

Sequence, based on SEQRES records:

>d2ew8b_ c.2.1.0 (B:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav
dggmvrh

Sequence, based on observed residues (ATOM records):

>d2ew8b_ c.2.1.0 (B:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh

Timeline for d2ew8b_:

• d2ew8b_ first appeared in SCOP 1.73, called d2ew8b1
  
• d2ew8b_ appears in SCOPe 2.06
  
• d2ew8b_ appears in the current release, SCOPe 2.08