Lineage for d2ew8b_ (2ew8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094360Species Azoarcus sp. [TaxId:76114] [187073] (1 PDB entry)
  8. 2094361Domain d2ew8b_: 2ew8 B: [132448]
    Other proteins in same PDB: d2ew8a1
    automated match to d1i01a_
    complexed with so4

Details for d2ew8b_

PDB Entry: 2ew8 (more details), 2.1 Å

PDB Description: Crystal Structure of the (S)-Specific 1-Phenylethanol Dehydrogenase of the Denitrifying Bacterium Strain EbN1
PDB Compounds: (B:) (S)-1-Phenylethanol dehydrogenase

SCOPe Domain Sequences for d2ew8b_:

Sequence, based on SEQRES records: (download)

>d2ew8b_ c.2.1.0 (B:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav
dggmvrh

Sequence, based on observed residues (ATOM records): (download)

>d2ew8b_ c.2.1.0 (B:) automated matches {Azoarcus sp. [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh

SCOPe Domain Coordinates for d2ew8b_:

Click to download the PDB-style file with coordinates for d2ew8b_.
(The format of our PDB-style files is described here.)

Timeline for d2ew8b_: