Lineage for d2evna1 (2evn A:1-103)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1214852Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1214970Protein Hypothetical protein AT1g77540 [118064] (1 species)
  7. 1214971Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (5 PDB entries)
    Uniprot Q8LEN2
  8. 1214976Domain d2evna1: 2evn A:1-103 [132436]

Details for d2evna1

PDB Entry: 2evn (more details)

PDB Description: nmr solution structures of at1g77540
PDB Compounds: (A:) Protein At1g77540

SCOPe Domain Sequences for d2evna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2evna1 d.108.1.1 (A:1-103) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi

SCOPe Domain Coordinates for d2evna1:

Click to download the PDB-style file with coordinates for d2evna1.
(The format of our PDB-style files is described here.)

Timeline for d2evna1: