PDB entry 2evn

View 2evn on RCSB PDB site
Description: NMR solution structures of At1g77540
Class: structural genomics, unknown function
Keywords: PSI structural genomics CESG At1g77540 Center for Eukaryotic structural genomics, Protein Structure Initiative, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-10-31, released 2005-11-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At1g77540
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2evna1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2evnA (A:)
    mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi