SCOPe 2.07: Domain d2evea1: 2eve A:2-149

Lineage for d2evea1 (2eve A:2-149)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
   Pfam PF01878; DUF55

6. Protein Hypothetical protein PSPTO5229 [141708] (1 species)
   PP5205 ortholog

7. Species Pseudomonas syringae [TaxId:317] [141709] (1 PDB entry)
   Uniprot Q87UR7 2-149

8. Domain d2evea1: 2eve A:2-149 [132427]
   Other proteins in same PDB: d2evea2
   complexed with 144, edo, mpo

Details for d2evea1

PDB Entry: 2eve, 1.6 Å

PDB Description: x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62

PDB Compounds: (A:) hypothetical protein PSPTO5229

SCOPe Domain Sequences for d2evea1:

Sequence; same for both SEQRES and ATOM records:

>d2evea1 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pseudomonas syringae [TaxId: 317]}
aywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgiag
igkivktaypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsqle
qlplvqkgsrlsvmpvtaeqwaailalr

Timeline for d2evea1:

• d2evea1 first appeared in SCOP 1.73
  
• d2evea1 appears in SCOPe 2.06
  
• d2evea1 appears in the current release, SCOPe 2.08