Lineage for d2evea1 (2eve A:2-149)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824000Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
    Pfam PF01878; DUF55
  6. 2824015Protein Hypothetical protein PSPTO5229 [141708] (1 species)
    PP5205 ortholog
  7. 2824016Species Pseudomonas syringae [TaxId:317] [141709] (1 PDB entry)
    Uniprot Q87UR7 2-149
  8. 2824017Domain d2evea1: 2eve A:2-149 [132427]
    Other proteins in same PDB: d2evea2
    complexed with 144, edo, mpo

Details for d2evea1

PDB Entry: 2eve (more details), 1.6 Å

PDB Description: x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62
PDB Compounds: (A:) hypothetical protein PSPTO5229

SCOPe Domain Sequences for d2evea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2evea1 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pseudomonas syringae [TaxId: 317]}
aywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgiag
igkivktaypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsqle
qlplvqkgsrlsvmpvtaeqwaailalr

SCOPe Domain Coordinates for d2evea1:

Click to download the PDB-style file with coordinates for d2evea1.
(The format of our PDB-style files is described here.)

Timeline for d2evea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2evea2