![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins) Pfam PF01878; DUF55 |
![]() | Protein Hypothetical protein PSPTO5229 [141708] (1 species) PP5205 ortholog |
![]() | Species Pseudomonas syringae [TaxId:317] [141709] (1 PDB entry) Uniprot Q87UR7 2-149 |
![]() | Domain d2evea1: 2eve A:2-149 [132427] Other proteins in same PDB: d2evea2 complexed with 144, edo, mpo |
PDB Entry: 2eve (more details), 1.6 Å
SCOPe Domain Sequences for d2evea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2evea1 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pseudomonas syringae [TaxId: 317]} aywlmksepdefsisdlqrlgkarwdgvrnyqarnflrtmaegdefffyhsscpepgiag igkivktaypdptaldpdshyhdakatteknpwsaldigfvdifknvlglgylkqqsqle qlplvqkgsrlsvmpvtaeqwaailalr
Timeline for d2evea1: