Class a: All alpha proteins [46456] (284 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Manganese transport regulator MntR [89086] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries) |
Domain d2ev6a2: 2ev6 A:63-136 [132422] Other proteins in same PDB: d2ev6a1, d2ev6b1 automatically matched to d1on1a2 complexed with flc, gol, zn |
PDB Entry: 2ev6 (more details), 1.7 Å
SCOPe Domain Sequences for d2ev6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ev6a2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkk
Timeline for d2ev6a2: