Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
Protein Manganese transport regulator MntR [88986] (1 species) |
Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
Domain d2ev6a1: 2ev6 A:4-62 [132421] Other proteins in same PDB: d2ev6a2, d2ev6b2 automatically matched to d1on1a1 complexed with flc, gol, zn |
PDB Entry: 2ev6 (more details), 1.7 Å
SCOPe Domain Sequences for d2ev6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ev6a1 a.4.5.24 (A:4-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
Timeline for d2ev6a1: